PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00484
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 317aa    MW: 35952.1 Da    PI: 8.7773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00484genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
       AA31G00484 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPANTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding46.39.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       AA31G00484  67 RGNFTQPEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.849965IPR017930Myb domain
SuperFamilySSF466891.91E-3012108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001672.26E-101661No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.00166116IPR017930Myb domain
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.0E-1367112IPR001005SANT/Myb domain
CDDcd001673.23E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MVRPPCCDKI EVKKGPWTPE EDIILVSYIQ QHGPGNWRSV PANTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQPEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKFQ  120
NGMINEDDQD NENNNNNKNV TESNNTNKSN NKRVPNKGQW EKRLQTDINM AKQALFQALS  180
LDQPSSSIPN SPPKLYHHCT TTTTTTTYAS STENISKLLQ KWTSNSSSSR PNTSSNNRSS  240
NSESGSVEGK LMSETSMFRG ESKPNLNMEI NVAAANSIND HGPFSLIEKW LFDDQGLVQC  300
GEHNQEDLIE ISLEDNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-26111161105MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-261111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAPTransfer from AT1G74650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177603.11e-151myb domain protein 31
SwissprotP813921e-103MYB06_ANTMA; Myb-related protein 306
TrEMBLQ9CA521e-151Q9CA52_ARATH; At1g74650
STRINGAT1G74650.11e-150(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-141myb domain protein 31